MPP1 Antibody PA5-79692 from Thermo Fisher Scientific | Biocompare.com

Supplier Images

WB

Western blot analysis of MPP1 in rat lung extract (lane 1), mouse spleen extract (lane 2) and MCF-7 whole cell lysate (lane 3). Sample was incubated with MPP1 polyclonal antibody (Product # PA5-79692) at a dilution of 0.5 µg/mL. Signal development was performed using a chemiluminescence (ECL) kit.
MPP1 Antibody

MPP1 Antibody

Be the first to write a review!

Supplier Page from
Thermo Fisher Scientific for
MPP1 Antibody

The MPP1 Antibody from Thermo Fisher Scientific is a Rabbit Polyclonal antibody to MAGUK p55 scaffold protein 1, and MPP1. This antibody recognizes Homo Sapiens, Human, Mouse, and Rat antigen. The MPP1 Antibody has been validated for the following applications: Flow Cytometry, Immunocytochemistry, and Western Blot.

Product Specs
ItemMPP1 Antibody
CompanyThermo Fisher Scientific
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberPA5-79692
Quantity100 µg
ApplicationsFlow Cytometry, Immunocytochemistry, Western Blot
Concentration500 µg/mL
Conjugate/TagUnconjugated
FormatPBS with 5mg BSA and 0.05mg sodium azide
PurityAntigen affinity chromatography
ReactivityHuman, Mouse, Rat
TargetMPP1
IsotypeIgG
HostRabbit
Antibody TypePrimary
Storage Temperature-20°C
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human MPP1 (409-450aa TEALQQLQKDSEAIRSQYAHYFDLSLVNNGVDETLKKLQEAF)
NCBI Full Gene Namemembrane protein, palmitoylated, MAGUK p55 scaffold protein 1
NCBI Gene AliasesAAG12, PEMP, DXS552E, C130070C03Rik, 55kDa, p55, MRG1, EMP55
ClonalityPolyclonal
Storage-20°C

Add to Compare List

Thermo Fisher Scientific

Thermo Fisher Scientific

Thermo Fisher Scientific

81 Wyman Street

Waltham, MA 02451

United States

Phone: 800-678-5599
Fax: 800-331-2286

Company Profile

Website: www.thermofisher.com

Be the First to Write a Review!